PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo14G0034500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Dof
Protein Properties Length: 409aa    MW: 43342.9 Da    PI: 7.3618
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo14G0034500genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.61.6e-39163222261
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                      +e+ lkcprCdst+tkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk+s
  Spipo14G0034500 163 HEQPLKCPRCDSTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGSLRNVPVGGGCRKNKRS 222
                      7899******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-30161221IPR003851Zinc finger, Dof-type
PfamPF027015.4E-33165221IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.357167221IPR003851Zinc finger, Dof-type
PROSITE patternPS013610169205IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MDIGKFKSSL ASELDFPYHV ILGYFTGGKS YNDDDDGDGG GILFVVEISY AGPSVWGGNR  60
RAGELTGVVA LSPPPPPAPA LEWAFGFRVP SFPKSDIFLV PPHHGEGHVS GFSLRLGKPP  120
PPTVWGPPAG EEGCMDSSSS MSGEIISCSR PPQAMERRLR PQHEQPLKCP RCDSTHTKFC  180
YYNNYSLSQP RYFCKTCRRY WTKGGSLRNV PVGGGCRKNK RSGGKKPAVD IPQTPQPAAP  240
PLNPLPSYPG LQLPHLGSLA GNSHGFALME CMLEGHSAVD GGEFGAALRN PGNLFFMGGG  300
AAPSAAGVRS MGGFGDMNHG FLSSTFHGSS PHGFSMDGGH SGVFMEAYQS TALNPVETKP  360
HEKLLSLEWQ QEQGCADVGR DGFCYPAGLG LWGGMMNGHG SSASNPLV*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3763889e-44AK376388.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3122H18.
GenBankAM0843609e-44AM084360.1 Hordeum vulgare subsp. vulgare dof12 gene for dof zinc finger protein 12, exons 1-2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010243051.14e-86PREDICTED: dof zinc finger protein DOF5.6-like
TrEMBLF6GSR11e-82F6GSR1_VITVI; Putative uncharacterized protein
STRINGVIT_17s0000g08290.t014e-82(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.11e-35Dof family protein